PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI05G19340.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 182aa    MW: 20381.6 Da    PI: 7.8409
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI05G19340.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding271e-082773347
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                     +W++ Ed+ +  a   ++ +   +W+++a++++ gR++ ++ +++q +
  ORUFI05G19340.1 27 PWSKAEDKVFESALVAFPEHthnRWALVASRLP-GRSAHEVWEHYQVL 73
                     8***************9999999**********.************86 PP

2Myb_DNA-binding45.32e-14114158347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++++ +++G g+W+ I+r   k+Rt+ q+ s+ qk+
  ORUFI05G19340.1 114 PWTEEEHRLFLEGLEKYGRGDWRNISRWSVKTRTPTQVASHAQKF 158
                      8******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512948.1472078IPR017930Myb domain
SMARTSM007172.7E-72476IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-72671IPR009057Homeodomain-like
SuperFamilySSF466895.31E-122681IPR009057Homeodomain-like
PfamPF002492.7E-72773IPR001005SANT/Myb domain
CDDcd001671.02E-62774No hitNo description
PROSITE profilePS5129419.617107163IPR017930Myb domain
SuperFamilySSF466895.18E-18109163IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-16111162IPR006447Myb domain, plants
SMARTSM007172.8E-10111161IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-11113154IPR009057Homeodomain-like
PfamPF002498.1E-11114157IPR001005SANT/Myb domain
CDDcd001672.60E-11114159No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MAFYLGSMGG SPSSWGVAEV PVPSSRPWSK AEDKVFESAL VAFPEHTHNR WALVASRLPG  60
RSAHEVWEHY QVLVDDVDLI ERGMVASPGC WDDDNNSAGH GRGSGGDERR RGVPWTEEEH  120
RLFLEGLEKY GRGDWRNISR WSVKTRTPTQ VASHAQKFFI RQANASSRGD SKRKSIHDIT  180
AP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-142489772RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1071340.0AK107134.1 Oryza sativa Japonica Group cDNA clone:002-124-C08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638220.11e-132PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H76e-50DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0D9ZZV11e-132A0A0D9ZZV1_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0PN451e-132A0A0E0PN45_ORYRU; Uncharacterized protein
TrEMBLA2Y5551e-132A2Y555_ORYSI; Putative uncharacterized protein
TrEMBLQ6F2M61e-132Q6F2M6_ORYSJ; Os05g0442400 protein
STRINGLOC_Os05g37060.11e-132(Oryza sativa Japonica Group)
STRINGBGIOSGA017964-PA1e-132(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28953687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.11e-42MYB family protein